Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G120500.1
Common NamePHAVU_004G120500g
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 744aa    MW: 81810.1 Da    PI: 5.6587
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G120500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++k +++t++q++ Le++F+++++p++++r++L+k+lgL+ +qVk+WFqNrR+++k
                         79999************************************************999 PP

               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         +a  a++elvk+a  + p+W kss    e +n +e+  +f++  v      + +ea ra+gvv + +  lve+++d+  +W+e++     +
                         57789*******************999999999*******774.35999*****************************.*****999999* PP

               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a tl+v+ssg      galq+m ae+q+lsplvp R   f+R+++q+ +g+wv+vdvSvd  ++  +s++++ +++lpSg++i+++ ng s
                         ****************************************************************999************************ PP

               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                         k+twveh  +++ ++h+l r+lv+sg+ +ga++w a l rqc 
                         **************************************99996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.86453113IPR001356Homeobox domain
SMARTSM003893.3E-1855117IPR001356Homeobox domain
CDDcd000862.60E-1856113No hitNo description
PfamPF000463.7E-1956111IPR001356Homeobox domain
PROSITE patternPS00027088111IPR017970Homeobox, conserved site
PROSITE profilePS5084844.696258494IPR002913START domain
SuperFamilySSF559611.51E-29261491No hitNo description
CDDcd088752.59E-96262489No hitNo description
SMARTSM002349.6E-36267491IPR002913START domain
PfamPF018521.6E-44268490IPR002913START domain
Gene3DG3DSA:3.30.530.207.7E-4321458IPR023393START-like domain
SuperFamilySSF559616.46E-14513707No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152327.10.0hypothetical protein PHAVU_004G120500g
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLV7C5Y80.0V7C5Y8_PHAVU; Uncharacterized protein
STRINGGLYMA16G32130.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein